MANBA_MOUSE   Q8K2I4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K2I4

Recommended name:Beta-mannosidase

EC number:EC 3.2.1.25

Alternative names:(Lysosomal beta A mannosidase) (Mannanase) (Mannase)

Cleaved into:

GeneID:110173

Gene names  (primary ):Manba

Gene names  (synonym ):Bmn

Gene names  (ORF ):

Length:879

Mass:100831

Sequence:MHLHLLLILALFRAGCVVAGPSYSLSGSWRVSNGNGSLELPATVPGYVHSALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDITNVVKDVNSLKLQFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGIWKDVRIEAYNIAHLDYLTFLPVYDNASQAWNIEIKASFDVASSKSVGGQVTVAIPQLKTQQTNDIELQQEQRIVKLLVKIRKDVAVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLIEEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSFQDKVTSDRLQLLFQSVVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHPSIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASSPTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFSTLEKVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHFKLPQGTDPLRTFKDTIYLTQVMQAQCIKTETEFYLRSRSEIVDGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPVGFEDEGVFYVYGVSDLHKDHHTQLTVRLHHWSSPKPLCSLVNSSIVVKAGEAVVLFQMPVSELLKRCRGCTRETCVVSFYFSTDKELFSPTNYHFLSSLKDAKGLLEANITVNISQKGNVFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMIRKKLSVLFYPWKPTSKSELQQAFSVTSLTDTY

Tissue specificity:Highest level in liver, high levels in lung, testis, skin and spleen, moderate level in thymus. Activity found in plasma, kidney, liver, spleen, pancreas, brain, testis, epididymis, heart, lung and skeletal muscle. {ECO:0000269|PubMed:11892998, ECO:0000269|PubMed:16377659}.

Induction:

Developmental stage:

Protein families:Glycosyl hydrolase 2 family


   💬 WhatsApp