CD52_MOUSE Q64389
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64389
Recommended name：CAMPATH-1 antigen
EC number：
Alternative names：(Lymphocyte differentiation antigen B7) (CD antigen CD52)
Cleaved into：
GeneID：23833
Gene names (primary )：Cd52
Gene names (synonym )：Cdw52 Mb7
Gene names (ORF )：
Length：74
Mass：7798
Sequence：MKSFLLFLTIILLVVIQIQTGSLGQATTAASGTNKNSTSTKKTPLKSGASSIIDAGACSFLFFANTLMCLFYLS
Tissue specificity：Expressed on lymphohematopoietic tissues, including thymus, spleen, and bone marrow, but not in liver, kidney, and brain.
Induction：
Developmental stage：
Protein families：