KLRA5_MOUSE Q60652
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60652
Recommended name：Killer cell lectin-like receptor 5
EC number：
Alternative names：(Lymphocyte antigen 49e) (Ly-49e) (T-cell surface glycoprotein Ly-49E)
Cleaved into：
GeneID：16636
Gene names (primary )：Klra5
Gene names (synonym )：Ly-49e Ly49-e Ly49e
Gene names (ORF )：
Length：266
Mass：30843
Sequence：MSEPEVTYSTVRLHKSSGLQRLVSHEEIQGPGEAGYRKCSVPWQLTVRSLGIFCFLLLVTVAVLAVKIFQYSQHKQEIHETLNHNHNCSNMQSDIKLKEEMLRNKSIDCSPGEELLESLNREQNRWYSETKTDLDSSQDTGTGVKHWFCYGTKCFYFIMSKNTWSGCKQTCQHYSLPLVKIEDEDELKFLQFQVISDSYWIGLSYDKKKKQWAWIDNGPSKLDMKTRKMNFKPGGCIFLSKTRLEDTNCNNSYFCICGKKLDHFPG
Tissue specificity：Mostly expressed in NK cells, but also observed on NK T and memory T-cells. {ECO:0000269|PubMed:11254682}.
Induction：
Developmental stage：
Protein families：