LY96_MOUSE   Q9JHF9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHF9

Recommended name:Lymphocyte antigen 96

EC number:

Alternative names:(Ly-96) (ESOP-1) (Protein MD-2)

Cleaved into:

GeneID:17087

Gene names  (primary ):Ly96

Gene names  (synonym ):Esop1 Md2

Gene names  (ORF ):

Length:160

Mass:18394

Sequence:MLPFILFSTLLSPILTESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Tissue specificity:Highly expressed in spleen, bone marrow, thymus, liver, kidney, ovary and decidua. Detected at lower levels in testis, small intestine and skin. {ECO:0000269|PubMed:10891475}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp