LY6I_MOUSE   Q9WU67


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WU67

Recommended name:Lymphocyte antigen 6I

EC number:

Alternative names:(Ly-6I) (Lymphocyte antigen 6M) (Ly-6M)

Cleaved into:

GeneID:57248

Gene names  (primary ):Ly6i

Gene names  (synonym ):Ly6m

Gene names  (ORF ):

Length:134

Mass:14714

Sequence:MDTSHAIKSCVLILLVTLLCAERAQGLECYQCYGVPFETSCPSFTCPYPDGFCVAQEEEFIANSQRKKVKSRSCHPFCPDEIEKKFILDPNTKMNISCCQEDLCNAAVPTGGSSWTTAGVLLFSLGSVLLQTLM

Tissue specificity:Expressed in hematopoietic tissue (spleen, thymus, bone marrow). Also found in peritoneal macrophages, peripheral blood leukocytes, liver, heart, brain, kidney and lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp