LY6G_MOUSE   P35461


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35461

Recommended name:Lymphocyte antigen 6G

EC number:

Alternative names:(Ly-6G) (Ly-6G.1)

Cleaved into:

GeneID:546644

Gene names  (primary ):Ly6g

Gene names  (synonym ):

Gene names  (ORF ):

Length:134

Mass:14324

Sequence:MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL

Tissue specificity:Expressed in bone marrow. {ECO:0000269|PubMed:8515066}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp