LY6D_MOUSE P35459
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35459
Recommended name：Lymphocyte antigen 6D
EC number：
Alternative names：(Ly-6D) (Thymocyte B-cell antigen) (ThB)
Cleaved into：
GeneID：17068
Gene names (primary )：Ly6d
Gene names (synonym )：Ly61 Thb
Gene names (ORF )：
Length：127
Mass：13396
Sequence：MKTALLVLLVLAVATSPAWALRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVSAAPGHALLSSVTLGLATSLSLLTVMALCL
Tissue specificity：Lymphoid cells lacking Ly6d, called ALP (all-lymphoid progenitor), retain full lymphoid potential and early thymic seeding activity, whereas cells containing Ly6d, called BLP (B-cell-biased lymphoid progenitor), up-regulate the B-cell specifying factors Ebf1 and Pax5 and behave essentially as B-cell progenitors (at protein level). Thymocytes and B-cells. {ECO:0000269|PubMed:19833765}.
Induction：
Developmental stage：
Protein families：