LYPD1_MOUSE Q8BLC3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BLC3
Recommended name：Ly6/PLAUR domain-containing protein 1
EC number：
Alternative names：(Ly-6/neurotoxin-like protein 2) (Lynx2)
Cleaved into：
GeneID：72585
Gene names (primary )：Lypd1
Gene names (synonym )：Lypdc1
Gene names (ORF )：MNCb-0671
Length：141
Mass：15261
Sequence：MWVLGIAATFCGLFWLPGLALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASAIRPGLLTTLLFFHLALCLAHC
Tissue specificity：Preferentially expressed in the nervous system. Expressed in embryonic and postnatal postmitotic central and peripheral neurons including subpopulations of motor neurons, sensory neurons, interneurons and neurons of the autonomous nervous system. Expressed around the growing nerves in the limb bud (PubMed:16236524). Expressed at high levels in specific brain regions such as the prefrontal cortex, amygdala, hippocampus, mediodorsal thalamus, dentate gyrus and specific brainstem nuclei (at protein level) (PubMed:19246390). {ECO:0000269|PubMed:16236524, ECO:0000269|PubMed:19246390}.
Induction：
Developmental stage：
Protein families：