PAHX_MOUSE   O35386


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35386

Recommended name:Phytanoyl-CoA dioxygenase, peroxisomal

EC number:EC 1.14.11.18

Alternative names:(Lupus nephritis-associated peptide 1) (Phytanic acid oxidase) (Phytanoyl-CoA alpha-hydroxylase) (PhyH)

Cleaved into:

GeneID:16922

Gene names  (primary ):Phyh

Gene names  (synonym ):Ln1 Lnap1 Pahx

Gene names  (ORF ):

Length:338

Mass:38607

Sequence:MNLTRAGARLQVLLGHLGRPSAPTIVAQPVSGLASPASFQPEQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVSDDDIQRFRAEFERICREEVKPPGIVIMRDVALAKQDYMPSDRMVSKIQDFQEDEELFRYCLLPEILKYVECFTGPNIMALHGMLINKPPDVGKKTSRHPLHQDLHYFPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYPKWEGGVNKMYHGIQDYDPNSPRVHLVMEKGDTVFFHPLLIHGSGRNKTQGFRKAISCHFGSSDCQCIDVSGTSQENIAREVVEMAEKKYGFQGVMDFKDTWIFRSRLVKGERINI

Tissue specificity:Ubiquitously expressed in all tissues with significant levels detected in the embryonic and neonatal heart and liver. In the adult, significant levels are detected in the liver, kidney, heart, gut, brain and aorta. {ECO:0000269|PubMed:10686344}.

Induction:

Developmental stage:

Protein families:PhyH family


   💬 WhatsApp