MBOA7_MOUSE Q8CHK3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CHK3
Recommended name：Lysophospholipid acyltransferase 7
EC number：EC 2.3.1.-
Alternative names：(LPLAT 7) (1-acylglycerophosphatidylinositol O-acyltransferase) (Bladder and breast carcinoma-overexpressed gene 1 protein) (Leukocyte receptor cluster member 4) (Lysophosphatidylinositol acyltransferase 1) (LPIAT1) (Membrane-bound O-acyltransferase domain-containing protein 7) (O-acyltransferase domain-containing protein 7) (m-mboa-7)
Cleaved into：
GeneID：77582
Gene names (primary )：Mboat7
Gene names (synonym )：Bb1 Leng4 Lpiat1 Oact7
Gene names (ORF )：
Length：473
Mass：53436
Sequence：MTPEEWTYLMVLLISIPVGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHSLHSLITILGTWALIQAQPCSCHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEIASGFHKEPTLGLLPEVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPEAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPTRLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEIAASLEYDYETIRNIDCYGTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPFRSYVLRSAWTMLLSAYWHGLHPGYYLSFMTIPLCLAAEGYLESALRRHLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSMADTLRYWASIYFWVHFLALACLGLGLVLGGGSPSKRKTPSQATSSQAKEKLREE
Tissue specificity：
Induction：
Developmental stage：
Protein families：Membrane-bound acyltransferase family