MBOA1_MOUSE Q8BH98
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BH98
Recommended name：Lysophospholipid acyltransferase 1
EC number：EC 2.3.1.-
Alternative names：(LPLAT 1) (1-acylglycerophosphocholine O-acyltransferase) (1-acylglycerophosphoethanolamine O-acyltransferase MBOAT1) (1-acylglycerophosphoserine O-acyltransferase MBOAT1) (Lysophosphatidylethanolamine acyltransferase 1) (LPE acyltransferase 1) (LPEAT1) (Lyso-PE acyltransferase) (Lysophosphatidylserine acyltransferase) (LPSAT) (Lyso-PS acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 1) (O-acyltransferase domain-containing protein 1)
Cleaved into：
GeneID：218121
Gene names (primary )：Mboat1
Gene names (synonym )：Lpeat1 Oact1
Gene names (ORF )：
Length：492
Mass：56160
Sequence：MAARPPASLSYRTTGSTCLHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCYGVMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRKAEDLSAEQHRLAVKAKPSLLEYLSYHLNFMSVIAGPCNNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLPEPSPMGAVIQKLCVTLMSLLLFLTLSKSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGFNGMDTDGKSRWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVPWYPTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQLAVSYTAAPFVMLAVEPTISLYKSVFFFLHIICLLIILFLPIKPHQPQRQSRSPNSVKKKAD
Tissue specificity：Highly expressed in stomach, epididymis, and colon. {ECO:0000269|PubMed:18287005}.
Induction：
Developmental stage：
Protein families：Membrane-bound acyltransferase family