LPAR6_MOUSE Q8BMC0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BMC0
Recommended name:Lysophosphatidic acid receptor 6
EC number:
Alternative names:(LPA receptor 6) (LPA-6) (Oleoyl-L-alpha-lysophosphatidic acid receptor) (P2Y purinoceptor 5) (P2Y5) (Purinergic receptor 5)
Cleaved into:
GeneID:67168
Gene names (primary ):Lpar6
Gene names (synonym ):P2ry5 P2y5
Gene names (ORF ):
Length:344
Mass:39439
Sequence:MVSSNGSQCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCFCFVPYNINLILYSLMRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI
Tissue specificity:Ubiquitously expressed. Detected in the hair follicles and skin (at protein level). {ECO:0000269|PubMed:18297070, ECO:0000269|PubMed:18297072}.
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family