DUS22_MOUSE   Q99N11


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99N11

Recommended name:Dual specificity protein phosphatase 22

EC number:EC 3.1.3.16

Alternative names:(Low molecular weight dual specificity phosphatase 2) (LMW-DSP2)

Cleaved into:

GeneID:105352

Gene names  (primary ):Dusp22

Gene names  (synonym ):

Gene names  (ORF ):

Length:184

Mass:20997

Sequence:MGSGMSQILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARPMLEGVKYLCIPAADTPSQNLTRHFKESIKFIHECRLQGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNLGFQRQLQEFEKHEVHQYRQWLREEYGENPLRDAEEAKNILAAPGILKYWAFLRRL

Tissue specificity:Specifically expressed in the testis. {ECO:0000269|PubMed:11346645}.

Induction:

Developmental stage:

Protein families:Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily


   💬 WhatsApp