LMO3_MOUSE   Q8BZL8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BZL8

Recommended name:LIM domain only protein 3

EC number:

Alternative names:(LMO-3) (Neuronal-specific transcription factor DAT1)

Cleaved into:

GeneID:109593

Gene names  (primary ):Lmo3

Gene names  (synonym ):

Gene names  (ORF ):

Length:145

Mass:16594

Sequence:MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp