LHPL1_MOUSE Q80SV1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80SV1
Recommended name：LHFPL tetraspan subfamily member 1 protein
EC number：
Alternative names：(Lipoma HMGIC fusion partner-like 1 protein)
Cleaved into：
GeneID：237091
Gene names (primary )：Lhfpl1
Gene names (synonym )：Lhfpl
Gene names (ORF )：
Length：220
Mass：23787
Sequence：MRNSLTMVGTFWAFLSLVTAVASSTSYFLPYWLFGSQLGKPVSFSTFRRCNYPVRGDGHNLIMVEECGRYASFTAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISAGCALYPLGWNSPEVMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVMLVENIMRNTNSYALELDHCLKP
Tissue specificity：Widely expressed (PubMed:26964900). Strongly expressed in vagina and ovary. Weakly expressed in spleen, kidney, thymus, testis, brain, lung, intestine and uterus (PubMed:26964900). {ECO:0000269|PubMed:26964900}.
Induction：
Developmental stage：
Protein families：LHFP family