LHPL1_MOUSE   Q80SV1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80SV1

Recommended name:LHFPL tetraspan subfamily member 1 protein

EC number:

Alternative names:(Lipoma HMGIC fusion partner-like 1 protein)

Cleaved into:

GeneID:237091

Gene names  (primary ):Lhfpl1

Gene names  (synonym ):Lhfpl

Gene names  (ORF ):

Length:220

Mass:23787

Sequence:MRNSLTMVGTFWAFLSLVTAVASSTSYFLPYWLFGSQLGKPVSFSTFRRCNYPVRGDGHNLIMVEECGRYASFTAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISAGCALYPLGWNSPEVMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVMLVENIMRNTNSYALELDHCLKP

Tissue specificity:Widely expressed (PubMed:26964900). Strongly expressed in vagina and ovary. Weakly expressed in spleen, kidney, thymus, testis, brain, lung, intestine and uterus (PubMed:26964900). {ECO:0000269|PubMed:26964900}.

Induction:

Developmental stage:

Protein families:LHFP family


   💬 WhatsApp