LMBRL_MOUSE   Q9D1E5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D1E5

Recommended name:Protein LMBR1L

EC number:

Alternative names:(Lipocalin-1-interacting membrane receptor) (LIMR) (Uteroglobin receptor)

Cleaved into:

GeneID:74775

Gene names  (primary ):Lmbr1l

Gene names  (synonym ):D15Ertd735e Kiaa1174

Gene names  (ORF ):

Length:489

Mass:54958

Sequence:MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFKKPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTLLVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQRVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAALGQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPRASRKKQHQ

Tissue specificity:Highly expressed in the bone marrow, thymus, spleen and lymphocytes. {ECO:0000269|PubMed:31073040}.

Induction:

Developmental stage:

Protein families:LIMR family


   💬 WhatsApp