BPIB3_MOUSE Q80ZU7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZU7
Recommended name：BPI fold-containing family B member 3
EC number：
Alternative names：(Ligand-binding protein RYA3) (Long palate, lung and nasal epithelium carcinoma-associated protein 3)
Cleaved into：
GeneID：378700
Gene names (primary )：Bpifb3
Gene names (synonym )：Lplunc3 Rya3
Gene names (ORF )：
Length：473
Mass：49885
Sequence：MMLGVYTLLLLWGLATPCLGLLETVGTLARIDKDELGKAIQNSLVGGPILQNVLGTVTSVNQGLLGAGGLLGGGGLLSYGGIFSLVEELSGLKIEELTLPKVSLKLLPGVGVQLNLHTKVSLHGSGPLVGLLQLAAEVNVSSKVALGMSPRGTPILVLKRCSTLLGHISLMSGLLPTPIFGLVEQTLCKVLPGLLCPVVDSVLSVVNELLGATLSLVPLGPLGSVEFTLATLPLISNQYIELDINPIVKSIAGDVIDFPKPRIPVKVPPKEDHTSQVTVPLYLFSTVFGLLQTNGALDLDITPEMVPRNVPLTTTDLAALAPEALGKLPPAQHLLLSLRVTKSPMVLLQNKKATVSIPVTIHVLSSVPQGTPVALFQLNGVMTLNAHLAPSSTKLHISLSLERLSVQLASSFPQPFDASRLEEWLSDVVRAAYMQRLNEHLEVGIPLPKILNVNFANSVVDIIENAVVLTVAP
Tissue specificity：
Induction：
Developmental stage：
Protein families：BPI/LBP/Plunc superfamily, BPI/LBP family