LIAT1_MOUSE   Q810M6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810M6

Recommended name:Protein LIAT1

EC number:

Alternative names:(Ligand of ATE1 protein)

Cleaved into:

GeneID:74230

Gene names  (primary ):Liat1

Gene names  (synonym ):

Gene names  (ORF ):

Length:228

Mass:25512

Sequence:MAGRGGTGAAEYGEEGEEEEEEEAREGGAEGSPGSKLPPIVGTASELAKRKVKKKKKKKKTKGSGKGDADKHHSRGRKNQPLSSSFHDILNPHKDHGLRAEPRDKEENRQTLPYSYSINHPCFAEIEDTLSSQINESLRWDGILTDPEAEKERIRIYKLNRRKRYRLMALKCFHSDPCVEESVENLPYLSDKDCSPCSKQPSSKGDHAHSYFEASKLLHPELATTVAE

Tissue specificity:Highly expressed in spleen, thymus, liver and brown adipose tissue. Moderately expressed in liver, testis and lung. {ECO:0000269|PubMed:25369936}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp