AAMDC_MOUSE   Q8R0P4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R0P4

Recommended name:Mth938 domain-containing protein

EC number:

Alternative names:(LI2)

Cleaved into:

GeneID:66273

Gene names  (primary ):Aamdc

Gene names  (synonym ):

Gene names  (ORF ):

Length:122

Mass:13244

Sequence:MASPKIASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVKEVAEKGVQTLVIGRGMSEALKVPPSTVEYLEKQGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC

Tissue specificity:Widely expressed, with high expression in the adipose tissue and skeletal muscle (at protein level). {ECO:0000269|PubMed:21622130}.

Induction:

Developmental stage:

Protein families:AAMDC family


   💬 WhatsApp