CD2_MOUSE P08920
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08920
Recommended name：T-cell surface antigen CD2
EC number：
Alternative names：(LFA-2) (LFA-3 receptor) (Lymphocyte antigen 37) (Ly-37) (T-cell surface antigen T11/Leu-5) (CD antigen CD2)
Cleaved into：
GeneID：12481
Gene names (primary )：Cd2
Gene names (synonym )：Ly-37
Gene names (ORF )：
Length：344
Mass：38415
Sequence：MKCKFLGSFFLLFSLSGKGADCRDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKDEELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN
Tissue specificity：Detected in thymus and spleen. {ECO:0000269|PubMed:2440689}.
Induction：
Developmental stage：
Protein families：