LZIC_MOUSE   Q8K3C3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K3C3

Recommended name:Protein LZIC

EC number:

Alternative names:(Leucine zipper and CTNNBIP1 domain-containing protein) (Leucine zipper and ICAT homologous domain-containing protein)

Cleaved into:

GeneID:69151

Gene names  (primary ):Lzic

Gene names  (synonym ):

Gene names  (ORF ):

Length:190

Mass:21537

Sequence:MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDADEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERELYTQRKVEILTALRKLGEKLTEDDETFLSANASAVLSQFEKVSTELGSGDKVLALAGFDVEKAKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:CTNNBIP1 family


   💬 WhatsApp