LETM2_MOUSE   Q7TNU7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TNU7

Recommended name:LETM1 domain-containing protein LETM2, mitochondrial

EC number:

Alternative names:(LETM1 and EF-hand domain-containing protein 2) (Leucine zipper-EF-hand-containing transmembrane protein 1-like)

Cleaved into:

GeneID:270035

Gene names  (primary ):Letm2

Gene names  (synonym ):

Gene names  (ORF ):

Length:480

Mass:54458

Sequence:MAFYSYNSFLAIFWTRLPGHSVYPSCSHFPSLAFLHLPDSHLRTAYIKNCGSRKYSYPSLTGNNKVHPLRTRLPQKLHTTCWLQHVPGKPQLEQTGKPKAASPQPTKEAKTETTEEKRSLRQKIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDASSQLSSYVKQVQTGHKPSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMTLKSIKADDEIIAKEGVKALSVSELQSACRARGMRSLGLTEEQLCQQLTGWLDLHLKENVPPSLLLLSRTFYLIDVKPKPIELPPNIETPKPNLGIPTPPPPESKENLTDSAPQLKGTKDEEFIQLPPVPSSLIAPAATISKEAILQAKSQETSQNSKADSKGA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp