MESD_MOUSE Q9ERE7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ERE7
Recommended name：LRP chaperone MESD
EC number：
Alternative names：(LDLR chaperone MESD) (Mesoderm development candidate 2) (Mesoderm development protein)
Cleaved into：
GeneID：67943
Gene names (primary )：Mesd
Gene names (synonym )：Mesdc2
Gene names (ORF )：
Length：224
Mass：25207
Sequence：MAASRWLRAVLLFLCASDLLLLPPPNAYAADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRREDL
Tissue specificity：Expressed in many tissues, but not in skeletal muscles (PubMed:11247670). In the retina expressed in retinal ganglion cells, inner and outer plexiform layers, photoreceptor inner and outer segments and retinal pigment epithelium (at protein level) (PubMed:27184668). {ECO:0000269|PubMed:11247670, ECO:0000269|PubMed:27184668}.
Induction：
Developmental stage：
Protein families：MESD family