DYLT2_MOUSE P11985
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P11985
Recommended name：Dynein light chain Tctex-type protein 2
EC number：
Alternative names：(LC2) (T-complex testis-specific protein 2) (T-complex testis-specific protein 3) (T-complex-associated testis-expressed protein 3) (Tcte-3) (T-complex-associated testis-expressed protein 4) (TCTEX-4) (TCTEX-2) (Tctex1 domain-containing protein 3)
Cleaved into：
GeneID：100041586
Gene names (primary )：Dynlt2
Gene names (synonym )：Tcte3 Tctex1d3 Tctex2 Tctex4
Gene names (ORF )：
Length：191
Mass：22379
Sequence：MERRGRMAKTPTGQTHQSPVSKRERKPSMFEKESYAQILRERLRESFHDVQYVEPPFDDSIADVGKEWKSALAKLKFANSYRMEPLKKFQAHLVETKIQQILKDSLKDVKYDDKAPHLSLELADGILAAVKEFAYHRYKFIIQVLFIQKTGQAINIASRWIWDVAWDNWVEAKHETESYVVLALVFALYCE
Tissue specificity：Expressed in testis (at protein level). Expressed at the pachyten stage of the first meiotic division and in later haploid spermatogenic stages. {ECO:0000269|PubMed:11278908, ECO:0000269|PubMed:12849985, ECO:0000269|PubMed:1718647, ECO:0000269|PubMed:3653077, ECO:0000269|PubMed:7601308}.
Induction：
Developmental stage：
Protein families：Dynein light chain Tctex-type family