LAMP1_MOUSE   P11438


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11438

Recommended name:Lysosome-associated membrane glycoprotein 1

EC number:

Alternative names:(LAMP-1) (Lysosome-associated membrane protein 1) (120 kDa lysosomal membrane glycoprotein) (CD107 antigen-like family member A) (LGP-120) (Lysosomal membrane glycoprotein A) (LGP-A) (P2B) (CD antigen CD107a)

Cleaved into:

GeneID:16783

Gene names  (primary ):Lamp1

Gene names  (synonym ):Lamp-1

Gene names  (ORF ):

Length:406

Mass:43865

Sequence:MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI

Tissue specificity:

Induction:

Developmental stage:

Protein families:LAMP family


   💬 WhatsApp