RM40_MOUSE   Q9Z2Q5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2Q5

Recommended name:39S ribosomal protein L40, mitochondrial

EC number:

Alternative names:(L40mt) (MRP-L40) (Nuclear localization signal-containing protein deleted in velocardiofacial syndrome homolog)

Cleaved into:

GeneID:18100

Gene names  (primary ):Mrpl40

Gene names  (synonym ):Nlvcf

Gene names  (ORF ):

Length:206

Mass:24301

Sequence:MATGVMLCAARALRPRSWIPGTCQAHVRHTHQRASLLAFWDLIPMRAEPLRKKKKVDPRKDQAAKDRLKKRIRKLEKASQELIPIEDFITPVRFLDKSRQRPQEEHSPEESERRALLLKRWALFKQQEHEMERDAIRSMLEAQQEALEELKLESAELYAEAIKRDTSLFPFEKEGPHYTPPISNYQAPEGRYNDITKVYTQVEFKR

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:9790763}.

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mL40 family


   💬 WhatsApp