RM32_MOUSE   Q9DCI9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCI9

Recommended name:39S ribosomal protein L32, mitochondrial

EC number:

Alternative names:(L32mt) (MRP-L32) (Heart-expressed gene 1 protein)

Cleaved into:

GeneID:75398

Gene names  (primary ):Mrpl32

Gene names  (synonym ):Heg1

Gene names  (ORF ):

Length:187

Mass:21733

Sequence:MAPSLLLLSLPWPVRPGPLQRCWELLQRQLQQSWSRFVSPPWAPALAVQRPSILTELAHDTCENKENSSFLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKIKNNIDICPECGHLKQKHVLCGYCYEKVRQETTKIRQQIGAQEGGPFRAPSVETMVLYTGEKPSEKDQGKRIVERNIKRPSWFTQN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Bacterial ribosomal protein bL32 family


   💬 WhatsApp