RM23_MOUSE O35972
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35972
Recommended name：39S ribosomal protein L23, mitochondrial
EC number：
Alternative names：(L23mt) (MRP-L23) (L23 mitochondrial-related protein)
Cleaved into：
GeneID：19935
Gene names (primary )：Mrpl23
Gene names (synonym )：L23mrp
Gene names (ORF )：
Length：146
Mass：17122
Sequence：MARNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHGSNRRRDHKNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEELPQQRQSSDLRCPGIPSWFGL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uL23 family