RM13_MOUSE   Q9D1P0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D1P0

Recommended name:39S ribosomal protein L13, mitochondrial

EC number:

Alternative names:(L13mt) (MRP-L13)

Cleaved into:

GeneID:68537

Gene names  (primary ):Mrpl13

Gene names  (synonym ):

Gene names  (ORF ):

Length:178

Mass:20677

Sequence:MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDFRM

Tissue specificity:

Induction:

Developmental stage:

Protein families:Universal ribosomal protein uL13 family


   💬 WhatsApp