KCNQ4_MOUSE Q9JK97
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK97
Recommended name:Potassium voltage-gated channel subfamily KQT member 4
EC number:
Alternative names:(KQT-like 4) (Potassium channel subunit alpha KvLQT4) (Voltage-gated potassium channel subunit Kv7.4)
Cleaved into:
GeneID:60613
Gene names (primary ):Kcnq4
Gene names (synonym ):
Gene names (ORF ):
Length:696
Mass:77057
Sequence:MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACGGQRSSAAQKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSRAYLTATWYYYDSILPSFRELALLFEHIQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHRPGSASFCPGESSRMGIKDRIRISSSQKRTGPSKQHLAPPPIPTSPSSEQVGEASSPSKVQKSWSFNDRTRFRASLRLKPRCSAEEGPSEEVAEEKSYQCELTVDDVMPAVKTVIRSVRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQARVDQIVGRGPGDRKTREKGDKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Tissue specificity:In the inner ear expressed in the outer sensory hair cells of the cochlea and in type I hair cells of the vestibular organs. Also expressed in the postsynaptic membrane of the calyx nerve endings innervating type I cells. In the brain expressed in neurons of many, but not all, nuclei of the central auditory pathway. Absent from most other brain regions. {ECO:0000269|PubMed:10760300}.
Induction:
Developmental stage:
Protein families:Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.4/KCNQ4 sub-subfamily