KISS1_MOUSE Q6Y4S4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6Y4S4
Recommended name：Metastasis-suppressor KiSS-1
EC number：
Alternative names：(Kisspeptin-1)
Cleaved into：Metastin (Kisspeptin-52); Kisspeptin-10 (Metastin45-54)
GeneID：280287
Gene names (primary )：Kiss1
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：14117
Sequence：MISMASWQLLLLLCVATYGEPLAKVAPLVKPGSTGQQSGPQELVNAWEKESRYAESKPGSAGLRARRSSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRYGRRQAARAARG
Tissue specificity：Weak in all tissue types with highest levels in lung and 15- 17-day embryos. Expressed in areas of the hypothalamus implicated in the neuroendocrine regulation of gonadotropin secretion, including the anteroventral periventricular nucleus, the periventricular nucleus, and the arcuate nucleus. {ECO:0000269|PubMed:12359743, ECO:0000269|PubMed:15217982}.
Induction：
Developmental stage：
Protein families：KISS1 family