KISSR_MOUSE   Q91V45


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91V45

Recommended name:KiSS-1 receptor

EC number:

Alternative names:(KiSS-1R) (G-protein coupled receptor 54) (G-protein coupled receptor OT7T175) (mOT7T175) (Kisspeptins receptor) (Metastin receptor)

Cleaved into:

GeneID:114229

Gene names  (primary ):Kiss1r

Gene names  (synonym ):Gpr54

Gene names  (ORF ):

Length:396

Mass:43061

Sequence:MATEATLAPNVTWWAPSNASGCPGCGVNASDDPGSAPRPLDAWLVPLFFATLMLLGLVGNSLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAPTDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYAAYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCRQRQRRPHTSAHSDRAATHTVPHSRAAHPVRIRSPEPGNPVVRSPCAQSERTASL

Tissue specificity:Highest level in the heart and 15- and 17-day embryos. Low level in other tissues. Colocalized with gonadotropin-releasing hormone (GnRH) neurons in the hypothalamus. {ECO:0000269|PubMed:11414709, ECO:0000269|PubMed:12359743, ECO:0000269|PubMed:15665093}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp