KLRB1_MOUSE   Q0ZUP1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q0ZUP1

Recommended name:Killer cell lectin-like receptor subfamily B member 1

EC number:

Alternative names:(Killer cell lectin-like receptor subfamily B member 1G) (Natural killer cell surface protein NKR-P1G) (Natural killer lectin-like receptor 1E)

Cleaved into:

GeneID:100043861

Gene names  (primary ):Klrb1

Gene names  (synonym ):Gm4696 Klrb1d Klrb1g Klrb6 Nkrp1g

Gene names  (ORF ):

Length:214

Mass:23909

Sequence:MDAPVLYAELNLAETRGLRCTSAPSLPQDACQGPGWHRVALKLGCAGLIFLLMVLSVLVGFLVQKPLIEKCSVAVQENRTEPTGRSATLECPRDWHPHCDKCLFTSQTSRPWADGLVDCNLKGATLLLIQDEEELRLLQNFSKGKGQQFYIGLKYEEVDKVWKWMNGSILNTNLLQITGKDEENSCALISQTEVFSDSCSSDNHWICQKTLKHV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp