OMD_MOUSE   O35103


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35103

Recommended name:Osteomodulin

EC number:

Alternative names:(Keratan sulfate proteoglycan osteomodulin) (KSPG osteomodulin) (Osteoadherin) (OSAD)

Cleaved into:

GeneID:27047

Gene names  (primary ):Omd

Gene names  (synonym ):

Gene names  (ORF ):

Length:423

Mass:49745

Sequence:MGFLSPIYVLFFCFGVRVYCQYEAYRWDDDYDQEPNEDYDPEFQFHQNIEYGVPFYNNILGCAKECFCPTNFPTSMYCDNRKLKTIPIIPMHIQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLSNLQQLHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHLSDSMLKEKTLSKMEKLMQLNLCNNRLESMPLGLPSSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPRNLEHLYLQNNEIESINVTMICPSPDPVHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSIYYGEQRSTNGETIQLKTQVFRSYQEEEEEDDHDSQDNTLEGQEVSDEHYNSHYYEMQEWQDTI

Tissue specificity:Bone specific.

Induction:

Developmental stage:

Protein families:Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily


   💬 WhatsApp