KBTBC_MOUSE   Q9D618


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D618

Recommended name:Kelch repeat and BTB domain-containing protein 12

EC number:

Alternative names:(Kelch domain-containing protein 6)

Cleaved into:

GeneID:74589

Gene names  (primary ):Kbtbd12

Gene names  (synonym ):Klhdc6

Gene names  (ORF ):

Length:625

Mass:71191

Sequence:MECKTKGKHQHSLNLLDKIKNMKELEEMIDVVLIAEEEKFPCHRLVLAAFSPYFKAMFTCGLLECTQREVILYDITAESVSVILNYMYSAVLEINNANVQTVAMAAYFMQMEEVFSVCQNYMMDHMDASNCIGIYYFAKQIGAEDLSDQSKKYLYQHFAEVSLHGEILDIEAHQLLALIKSDDLNISREESILDLVLRWVNHNQALRTEHLVELLKQVRLELINASFLRQALRRNTMLLCDGSCIDIIQNAFKAIKTPQQHPSNLRYGMETTSLLLCIGNNSSGIRSRHRSYGDASFCYDPVSHKTYFISSPKYGEGLGTVCTGVVMENNTVIVAGEATATRLSRQKSKNIEIYRYHDRGNQFWEKLCTAEFRELYALGSIHNDLYVIGGQMKIKNQYLITNCVDKYSVDQDNWKRVSPLPLQLACHAVVTVNNKLYVIGGWTPQMDLPDEEPDRLSNKLLQYDPSQDQWRERAPMRYSKYRFSAAVVNSEIYVLGGIGCVGRDKGQVRKCLDVVEIYNPDGDFWREGPPMPSPLLSLRTNSTSAGAVDGKLYVCGGFHGADRHEVISKEILELDPWENQWNVVAINVLMHDSYDVCLVARMNPRDLIPPPSDLIEEDGDHRGQR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp