NAPSA_MOUSE   O09043


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O09043

Recommended name:Napsin-A

EC number:EC 3.4.23.-

Alternative names:(KDAP-1) (Kidney-derived aspartic protease-like protein) (KAP)

Cleaved into:

GeneID:16541

Gene names  (primary ):Napsa

Gene names  (synonym ):Kdap Nap

Gene names  (ORF ):

Length:419

Mass:45544

Sequence:MSPLLLLLLCLLLGNLEPEEAKLIRVPLQRIHLGHRILNPLNGWEQLAELSRTSTSGGNPSFVPLSKFMNTQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVPPLTFIPVTIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGGYPFLNGQYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPKPAGPLWILGDVFLGPYVAVFDRGDKNVGPRVGLARAQSRSTDRAERRTTQAQFFKRRPG

Tissue specificity:Expressed at the highest levels in the kidney, at a moderate level in the lung, and at low levels in the spleen and adipose tissue. {ECO:0000269|PubMed:9013890}.

Induction:

Developmental stage:

Protein families:Peptidase A1 family


   💬 WhatsApp