KCIP4_MOUSE   Q6PHZ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PHZ8

Recommended name:Kv channel-interacting protein 4

EC number:

Alternative names:(KChIP4) (A-type potassium channel modulatory protein 4) (Calsenilin-like protein) (Potassium channel-interacting protein 4)

Cleaved into:

GeneID:80334

Gene names  (primary ):Kcnip4

Gene names  (synonym ):Calp Kchip4

Gene names  (ORF ):

Length:250

Mass:28756

Sequence:MNVRRVESISAQLEEASSTGGFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI

Tissue specificity:Expressed in brain. Highly expressed by neurons in layers II-IV of cortex and in hippocampus, thalamus and the Purkinje cell layer of the cerebellum. {ECO:0000269|PubMed:11805342, ECO:0000269|PubMed:11847232, ECO:0000269|PubMed:15363885}.

Induction:

Developmental stage:

Protein families:Recoverin family


   💬 WhatsApp