KCAB3_MOUSE P97382
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97382
Recommended name：Voltage-gated potassium channel subunit beta-3
EC number：
Alternative names：(K(+) channel subunit beta-3) (Kv-beta-3)
Cleaved into：
GeneID：
Gene names (primary )：Kcnab3
Gene names (synonym )：
Gene names (ORF )：
Length：249
Mass：27749
Sequence：MSRGYGLIFSLKVVFTFLSLPHPPGLQGSLDRLQLEYVDIVFANRSDPNSPMEEIVRAMTYVINQGLALYWGTSRWSAAEIMEAYSMARQFNLIPPVCEQAENHFFQREKVEMQLPELYHKIGVGSVTWSPLACGLITSKYDGRVPDTCKATVKGYQWLKEKVQSEEGKKQQARVMDLLPTARQLGCTVGQLAIAWCLRSEGVSSVLLGVSSAEQLMEHLGSLQVLSQLTPQTVVEIDALLGNKSHSKK
Tissue specificity：Strong expression in brain, with highest levels in neocortical and allocortical regions, hippocampus, olfactory bulb and cerebellum. Also strong in kidney. Weak expression in lung, skeletal muscle and heart. {ECO:0000269|PubMed:8824288}.
Induction：
Developmental stage：
Protein families：Shaker potassium channel beta subunit family