JAM2_MOUSE Q9JI59
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JI59
Recommended name:Junctional adhesion molecule B
EC number:
Alternative names:(JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)
Cleaved into:
GeneID:67374
Gene names (primary ):Jam2
Gene names (synonym ):Vejam
Gene names (ORF ):
Length:298
Mass:33047
Sequence:MARSPQGLLMLLLLHYLIVALDYHKANGFSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLNISGIIATVVVVAFVISVCGLGTCYAQRKGYFSKETSFQKGSPASKVTTMSENDFKHTKSFII
Tissue specificity:Expressed by bone marrow stromal cells (at protein level) (PubMed:21868569). Expressed in skin (at protein level) (PubMed:16297198). Expressed in testis by Sertoli cells (at protein level) (PubMed:15372036, PubMed:25817991). Expressed by dorsal root ganglion and spinal cord neurons (PubMed:27499083). {ECO:0000269|PubMed:15372036, ECO:0000269|PubMed:16297198, ECO:0000269|PubMed:21868569, ECO:0000269|PubMed:25817991, ECO:0000269|PubMed:27499083}.
Induction:
Developmental stage:
Protein families:Immunoglobulin superfamily