JAM1_MOUSE   O88792


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88792

Recommended name:Junctional adhesion molecule A

EC number:

Alternative names:(JAM-A) (Junctional adhesion molecule 1) (JAM-1) (CD antigen CD321)

Cleaved into:

GeneID:16456

Gene names  (primary ):F11r

Gene names  (synonym ):Jam1 Jcam Jcam1

Gene names  (ORF ):

Length:300

Mass:32424

Sequence:MGTEGKAGRKLLFLFTSMILGSLVQGKGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Immunoglobulin superfamily


   💬 WhatsApp