DJC12_MOUSE   Q9R022


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R022

Recommended name:DnaJ homolog subfamily C member 12

EC number:

Alternative names:(J domain-containing protein 1)

Cleaved into:

GeneID:30045

Gene names  (primary ):Dnajc12

Gene names  (synonym ):Jdp1

Gene names  (ORF ):

Length:198

Mass:22853

Sequence:MDAILNYRPEGSEDYYALLGCDELSSVEQILAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRRSQMSMPFEQWEALADSVKTSMHWAVRSKKDLMLEGSGQTFTSSVPNKERSEQRETKKGDPDSNPEKMKQKEPKFPEEGISPQNPDSPGLSDLNCGHLRFRWSGDAPSELLRKFRNYEI

Tissue specificity:Ubiquitous. Highest levels of expression in kidney.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp