G6B_MOUSE D7PDD4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D7PDD4
Recommended name：Megakaryocyte and platelet inhibitory receptor G6b
EC number：
Alternative names：(ITIM-receptor G6b-B) (Immunoreceptor tyrosine-based inhibitory motif (ITIM)-containing platelet receptor)
Cleaved into：
GeneID：106722
Gene names (primary )：Mpig6b
Gene names (synonym )：AU023871 G6b G6b-B
Gene names (ORF )：
Length：242
Mass：26010
Sequence：MALVLPLLPLLLSKVQGNPEVSLEGSPGDRVNLSCIGVSDPTRWAWAPSFPACKGLSKGRRPILWASTRGTPTVLQHFSGRLRSLDNGIKRLELLLSAGDSGTFFCKGRHENESRTVLQVLGDKAGCRPAGSTHGYEYPKVLIPLLGVGLVLGLGVAGVVWRRRRLSPPPPPPPPPGPLPTFAPVINAEPQRPLEQESKISGHLDQEPSLHYADLDHSVLGRHRRMSTVVSGDASTVYAVVV
Tissue specificity：Espressed in mature megakaryocytes and platelets. Not expressed by immature megakaryocytes. {ECO:0000269|PubMed:23112346}.
Induction：
Developmental stage：
Protein families：