KCJ10_MOUSE Q9JM63
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM63
Recommended name：ATP-sensitive inward rectifier potassium channel 10
EC number：
Alternative names：(Inward rectifier K(+) channel Kir4.1) (Potassium channel, inwardly rectifying subfamily J member 10)
Cleaved into：
GeneID：16513
Gene names (primary )：Kcnj10
Gene names (synonym )：
Gene names (ORF )：
Length：379
Mass：42432
Sequence：MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Tissue specificity：Widely expressed in adult brain, including in the neocortex, the stratum pyrimadale of the hippocampus and the piriform cortex. Expressed by cultured astrocytes and also by cocultured cortical neurons (at protein level). {ECO:0000269|PubMed:11169792}.
Induction：
Developmental stage：
Protein families：Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily