MIIP_MOUSE   A2A7Y5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2A7Y5

Recommended name:Migration and invasion-inhibitory protein

EC number:

Alternative names:(Invasion-inhibitory protein 45) (IIp45)

Cleaved into:

GeneID:28010

Gene names  (primary ):Miip

Gene names  (synonym ):D4Wsu114e Iip45

Gene names  (ORF ):

Length:387

Mass:42828

Sequence:MPNMAETKDPVRLRLLSLELLKQLWAGHEAMCRSVVRAASGSNLDCSSNNLEMPLSQETSSASSVAPSSQDKRHMLDPLDSRRDDTFDVAWYVKFNSRMDSFLPATGQHQEPQEELRPPSVPLLATQGLKGPVSLGGPKGLGPDKTQVPRSILSRLSKPSKPRVTSQESAVPESSWHSRPYLGYDWIAGSLDNSSPVTSEPEAFFSMLQRFRENNKEDCVCNSPEAVFPGLQESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVEPVQVRVSIPLSIMDPPHQYRIHRRKSFDASDTLALPRHCLLGWDILPPKSEKTSVPKSLDLWSSVSYGAGQRRDLSATSPPCQALPAQVTPPLWSEPQVAQLCPSH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp