SOSSC_MOUSE   Q3TXT3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TXT3

Recommended name:SOSS complex subunit C

EC number:

Alternative names:(INTS3- and NABP-interacting protein) (Sensor of single-strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS-C) (Single-stranded DNA-binding protein-interacting protein 1) (SSB-interacting protein 1)

Cleaved into:

GeneID:66209

Gene names  (primary ):Inip

Gene names  (synonym ):Ssbip1

Gene names  (ORF ):

Length:104

Mass:11411

Sequence:MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTSHPGASISLSRPSLTKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

Tissue specificity:

Induction:

Developmental stage:

Protein families:SOSS-C family


   💬 WhatsApp