CCL7_MOUSE   Q03366


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q03366

Recommended name:C-C motif chemokine 7

EC number:

Alternative names:(Intercrine/chemokine MARC) (Monocyte chemoattractant protein 3) (Monocyte chemotactic protein 3) (MCP-3) (Protein FIC) (Small-inducible cytokine A7)

Cleaved into:

GeneID:20306

Gene names  (primary ):Ccl7

Gene names  (synonym ):Fic Mcp3 Scya7

Gene names  (ORF ):

Length:97

Mass:10999

Sequence:MRISATLLCLLLIAAAFSIQVWAQPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp