C560_MOUSE   Q9CZB0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CZB0

Recommended name:Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

EC number:

Alternative names:(Integral membrane protein CII-3) (QPs-1) (QPs1)

Cleaved into:

GeneID:66052

Gene names  (primary ):Sdhc

Gene names  (synonym ):

Gene names  (ORF ):

Length:169

Mass:18382

Sequence:MAAFLLRHVSRHCLRAHLNAQLCIRNAAPLGTTAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGGLAAL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome b560 family


   💬 WhatsApp