INSL5_MOUSE   Q9WUG6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WUG6

Recommended name:Insulin-like peptide INSL5

EC number:

Alternative names:(Insulin-like peptide 5) (Relaxin/insulin-like factor 2) (Relaxin/insulin-like protein)

Cleaved into:Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain

GeneID:23919

Gene names  (primary ):Insl5

Gene names  (synonym ):Rif Rif2 Zins3

Gene names  (ORF ):

Length:135

Mass:15524

Sequence:MKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSRWRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLWELKKHSVVSRRDLQALCCREGCSMKELSTLC

Tissue specificity:Highest expression in colon with lower levels in thymus. Minimal levels in testis. {ECO:0000269|PubMed:10458910}.

Induction:

Developmental stage:

Protein families:Insulin family


   💬 WhatsApp