CNBP1_MOUSE   Q9JJN6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJN6

Recommended name:Beta-catenin-interacting protein 1

EC number:

Alternative names:(Inhibitor of beta-catenin and Tcf-4)

Cleaved into:

GeneID:67087

Gene names  (primary ):Ctnnbip1

Gene names  (synonym ):Catnbip1 Icat

Gene names  (ORF ):

Length:81

Mass:9174

Sequence:MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQGAEDVVMAFSRSETEDRRQ

Tissue specificity:Highly expressed in heart, brain, liver and skeletal muscle. Detected at low levels in kidney, testis and lung.

Induction:

Developmental stage:

Protein families:CTNNBIP1 family


   💬 WhatsApp