S22AI_MOUSE Q78KK3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q78KK3
Recommended name：Solute carrier family 22 member 18
EC number：
Alternative names：(Imprinted multi-membrane-spanning polyspecific transporter-related protein 1) (Multi-membrane-spanning polyspecific transporter) (Organic cation transporter-like protein 2) (ORCTL-2)
Cleaved into：
GeneID：18400
Gene names (primary )：Slc22a18
Gene names (synonym )：Impt1 Itm Orctl2 Tssc5
Gene names (ORF )：
Length：406
Mass：43013
Sequence：MAALPRQGIIILTYVLAALELTCLFMQFSILPYLSRTLGLDSVSFGYLQTTFGVLQLLGGPVFGRFADQCGARAALSLSFLAASALYLLLVASCSPALPGVFLLFASRIPSALMHTLPAAQMVITDLTAPTERPAALGRLGLCFGIGIIFGSLLGGTLNTAYGIQCPAILAFVVTLLGAVLSFTCVPATTKEASVQSAPQGGTKASVFDLKAITRLLLLPRVLPVFLVKVISGLPSGLFLVMFSIISMDFFQLEAAQAGYLMSFFGILQMMIQGLVIGRLSTHFPEEALLRSSVLVFAVVGLGMALMSSVLHFCFLMPGLVFSLCTLNVVTDSMLTKAVSASDTGTMLGLSASVQPLTRTLGPTLGGLLYRSYGVPIFGHVQLMVNLLVLLVLWKKPLSQKGEKAR
Tissue specificity：Expressed at high levels in fetal and adult kidney and liver, and extraembryonic membranes (yolk sac). Expressed at moderate levels in intestine, heart, lung and testis. {ECO:0000269|PubMed:9499412, ECO:0000269|PubMed:9570947, ECO:0000269|PubMed:9802569}.
Induction：
Developmental stage：
Protein families：Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family